In silico characterization of boron transporter (BOR1) protein sequences in Poaceae species

Journal Title: Journal of BioScience and Biotechnology - Year 2013, Vol 2, Issue 2

Abstract

Boron (B) is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1) sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum) were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

Authors and Affiliations

Ertuğrul Filiz

Keywords

Related Articles

 Changes in composition and structure of breeding bird communities due to successive changes in ecosystems

 Successive changes in ecosystems are due to natural and/or anthropogenic influences. These changes influence species richness and structure of phyto- and zoocenoses. Birds represent a good indicator for changes of...

Ecological estimation of swards grown in the region of Middle Balkan Mountains

One of the main problems in contemporary agrarian production is the irrational utilization and management of natural resources as well as non-compliance with the biological characteristics of particular species in accord...

Soybean long-term callus cultures – potential for biotransformation and nutraceutical production

Soybean (Glycine max (L.) Merrill.) is the world leading cultivated pulse crop as a source of protein, oil and nutraceuticals. Recently, alternative approaches for the synthesis of new products gain bigger interest. Biot...

Phytochemical analysis and antimicrobial activity of baobab (Adansonia digitata) leaves and steam bark extracts on Staphylococcus aureus and Escherichia coli

The phytochemical analysis and antibacterial activity of methanolic and ethanolic leaf and stem bark extracts of baobab tree on Escherichia coli and Staphylococcus aureus were carried out using agar well diffusion method...

 Application of ISSR to study the genetic diversity of honeybee (Apis mellifera L.) populations in some areas of Iran

 Inter-Simple Sequence Repeat (ISSR) molecular marker for the isolation of five races of honey bee Apis mellifera from Khuzestan, Kurdistan, Markazi, Fars and Isfahan provinces was studied. DNA was extracted from t...

Download PDF file
  • EP ID EP115035
  • DOI -
  • Views 24
  • Downloads 0

How To Cite

Ertuğrul Filiz (2013). In silico characterization of boron transporter (BOR1) protein sequences in Poaceae species. Journal of BioScience and Biotechnology, 2(2), 137-144. https://europub.co.uk/articles/-A-115035