In silico characterization of boron transporter (BOR1) protein sequences in Poaceae species
Journal Title: Journal of BioScience and Biotechnology - Year 2013, Vol 2, Issue 2
Abstract
Boron (B) is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1) sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum) were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.
Authors and Affiliations
Ertuğrul Filiz
Keywords
Related Articles
- EP ID EP115035
- DOI -
- Views 69
- Downloads 0
Soybean long-term callus cultures – potential for biotransformation and nutraceutical production
Soybean (Glycine max (L.) Merrill.) is the world leading cultivated pulse crop as a source of protein, oil and nutraceuticals. Recently, alternative approaches for the synthesis of new products gain bigger interest. Biot...
Statistical optimization of critical medium components for biosurfactant production by Bacillus subtilis
In the present study optimization of the critical medium components for biosurfactant production by Bacillus subtilis using statistical experimental design was studied. Response surface methodology (RSM) was employ...
Production of ACE-inhibitory peptides in milk fermented with selected lactic acid bacteria
The ability of lactic acid bacteria to release bioactive peptides is strain specific and is dependent on the dairy processing conditions. In the present study, we developed a starter for fermented milk with increased pro...
Root biomass accumulation in some varieties and hybrids of pea (Pisum sativum L.)
Root biomass accumulation in spring and winter varieties and hybrids pea was recorded in field experiment in the Institute of Forage Crops, Pleven, Bulgaria (2011-2013). Spring (Shtambovyi and Pleven 4) and winter...
New data about some rare and less known discomycetous fungi from Bulgaria
New data for six discomycetes from orders Helotiales and Rhytismatales in Bulgaria are presented herein. Three of them (Ombrophila violacea, Rutstroemia bulgarioides and R. calopus) are of high conservation value.