Insilico Prediction of T-cell Epitopes to Therapeutic Interferon -Beta (IFN-β) Protein
Journal Title: Biotechnology Journal International - Year 2016, Vol 16, Issue 3
Abstract
Aims: Several studies have reported the existence for T helper cell epitopes with the persistence of unwanted immune reactions for several protein drugs. T-cell epitope is an amino acid or set of amino acids that are capable of being recognized form one or more T-cell receptors. There is also an indication that T helper cells are involved in the anti-drug antibodies development to therapeutic interferon beta-1a. Protein drugs containing Major histocompatibility complex class II T cell epitopes are likely to elicit anti-drug antibodies. Binding specificity between T-cell epitopes and major histocompatibility molecules are the most important determinant step in finding the T-cellular immune responses. The data obtained from the present study provides new insights into prediction of therapeutic Interferon beta T helper cells epitopes using T cell epitope prediction tools, mapping of clusters of predicted epitopes. Study Design: Insilico analysis by bioinformatics tools was to predict T-cell epitopes of Interferon beta-1a. Methodology: Several Insilico prediction tools (immunoinformatics tools) including Proped, NetMHCIIpan3.0 and Immune Epitope Database Analysis Resource (IEDB-AR) are available to map the potential major histocompatibility class II T cell epitopes. After predicting potential T-cell epitopes, epitopes were mapped on interferon beta-1a using MIMOX2 server. Results: The potential MHC class II immunogenic sequence of 50 amino acids “TRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTG” With IFN-β-1a (position 111-161) were identified. This study can provide the understanding the relevance to T-cell activation for prediction and assessment of unwanted immune responses. Conclusions: Insilico prediction by using the available tools helps in reducing the time and cost for the immunologists during the vaccine design. By predicting them we will come to know, which peptides play major role and synthesize them using invitro technologies.
Authors and Affiliations
Venkata Bharat Kumar Pinnelli, Swathi Krishna Reddy
Keywords
Related Articles
- EP ID EP237913
- DOI 10.9734/BJI/2016/29184
- Views 115
- Downloads 0
Enhanced in vitro Seedling Recovery in Nothapodytes nimmoniana (J. Graham) Mabberly
Nothapodytes nimmoniana is an endangered medicinal tree and regarded most convenient natural source for large scale isolation of anticancer alkaloid camptothecin. In order to meet pharmaceutical market demand for camptot...
Optimization of Operating Conditions Affecting Microbiologically Influenced Corrosion of Mild Steel Exposed to Crude Oil Environments Using Response Surface Methodology
In this study, the influence of four operating parameters (pH, salinity, nitrate concentration and immersion time) and their interactions on the microbiologically influenced corrosion (MIC) rate of mild steel in simulate...
Ficus religiosa L.: Callus, Suspension Culture and Lectin Activity in Fruits and In vitro Regenerated Tissues
Ficus religiosa L. is a tree of immense cultural heritage in Asian countries. It is respected by followers of many religions and faiths. Fruits of Ficus religiosa L. are the ‘figs’ and possess many medicinal properties r...
Fungal Infection Enhances Anthocyanin Production in Blue Flowers of Clitoria ternatea
Aims: A white fungus which commonly infects blue petals of Clitoria ternatea L. (CT) was identified and total anthocyanin content and antioxidant activity of CT extracts from infected and uninfected CT were compared. St...
Gradual Changes in Genetic Based Developments for Phylogenetic Trends in Picornaviruses
On the basis of the several techniques, the new groups and the strains within the Picornaviruses were classified. New groups like human pathogen EV22 (Echovirus 22) was discovered that was found to be highly different fr...