Insilico Prediction of T-cell Epitopes to Therapeutic Interferon -Beta (IFN-β) Protein

Journal Title: Biotechnology Journal International - Year 2016, Vol 16, Issue 3

Abstract

Aims: Several studies have reported the existence for T helper cell epitopes with the persistence of unwanted immune reactions for several protein drugs. T-cell epitope is an amino acid or set of amino acids that are capable of being recognized form one or more T-cell receptors. There is also an indication that T helper cells are involved in the anti-drug antibodies development to therapeutic interferon beta-1a. Protein drugs containing Major histocompatibility complex class II T cell epitopes are likely to elicit anti-drug antibodies. Binding specificity between T-cell epitopes and major histocompatibility molecules are the most important determinant step in finding the T-cellular immune responses. The data obtained from the present study provides new insights into prediction of therapeutic Interferon beta T helper cells epitopes using T cell epitope prediction tools, mapping of clusters of predicted epitopes. Study Design: Insilico analysis by bioinformatics tools was to predict T-cell epitopes of Interferon beta-1a. Methodology: Several Insilico prediction tools (immunoinformatics tools) including Proped, NetMHCIIpan3.0 and Immune Epitope Database Analysis Resource (IEDB-AR) are available to map the potential major histocompatibility class II T cell epitopes. After predicting potential T-cell epitopes, epitopes were mapped on interferon beta-1a using MIMOX2 server. Results: The potential MHC class II immunogenic sequence of 50 amino acids “TRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTG” With IFN-β-1a (position 111-161) were identified. This study can provide the understanding the relevance to T-cell activation for prediction and assessment of unwanted immune responses. Conclusions: Insilico prediction by using the available tools helps in reducing the time and cost for the immunologists during the vaccine design. By predicting them we will come to know, which peptides play major role and synthesize them using invitro technologies.

Authors and Affiliations

Venkata Bharat Kumar Pinnelli, Swathi Krishna Reddy

Keywords

Related Articles

Effect of Gas Flaring on the Phytochemical and Nutritional Composition of Treculia africana and Vigna subterranean

Aims: The effect of petroleum exploration and exploitation activities on the phytochemical and nutritional composition of African breadfruit (Treculia africana) and Bambara groundnuts (Vigna subterranean) harvested from...

Waste Oil Biodegradation Potential among Bacteria Isolates from Waste Oil and Pristine Soils

The research study was aimed at investigating waste oil biodegradation potential among bacteria isolates from waste oil and pristine soil samples. Auto-mechanic workshop and pristine soil environments were randomly sampl...

Relationship between Neutral Invertase Activity and Sugar Contents in Tomato Fruit and Its Functional Prediction Analysis

Aims: Neutral invertase (NI) probably plays an important role in sucrose metabolism of tomato, but main function and mechanism are unclear. In this study, contents of soluble sugar and NI activity were measured at differ...

Efficient Micropropagation of Spilanthes acmella (L.) Murr.: A Threatened Medicinal Herb

The present study describes an efficient and reproducible protocol for micropropagation of S. acmella. Shoot tips taken from 3 week-old aseptic seedlings were cultured on Murashige and Skoog (MS) semi-solid medium supple...

Isolation and 16S rRNA-Based Identification of Benomyl-Degrading Bacteria

Laboratory experiments were conducted to isolate and identify Benlate- (Benomyl) degrading microorganisms from two soil types collected from different locations in Khartoum State, Sudan. Benomyl degradation was studied a...

Download PDF file
  • EP ID EP237913
  • DOI 10.9734/BJI/2016/29184
  • Views 133
  • Downloads 0

How To Cite

Venkata Bharat Kumar Pinnelli, Swathi Krishna Reddy (2016). Insilico Prediction of T-cell Epitopes to Therapeutic Interferon -Beta (IFN-β) Protein. Biotechnology Journal International, 16(3), 1-23. https://europub.co.uk/articles/-A-237913